Tesamorelin

Synthetic peptide research material supplied as a warehouse-specific analytical catalog material. Select the required pack configuration before adding it to the cart.

Catalog number: VB-USA-TESAMORELIN
Material class: Synthetic peptide research material
Fulfilment: Selected regional warehouse only
Availability: Pack-specific; sold-out configurations remain visible

Scientific reference profile

CAS: 218949-48-5
PubChem CID: 16137828
Molecular formula: C221H366N72O67S
Molecular mass: 5136 g/mol
Sequence / composition notation: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
Reference sources: PubChem record

Reference 2D structure from PubChem. Open source record

Chemical identifiers and 2D structure are sourced from the linked PubChem record.

Documentation and handling

Identity, purity, storage requirements, and analytical suitability must be evaluated against the batch-specific documentation. Reference identifiers on this page do not establish the identity or purity of a dispatched batch.

Use appropriate laboratory controls, containment, and validated analytical methods.
Keep the material secured and accessible only to qualified personnel.

Unlabeled primary vial

Actual dispatched vials are unlabeled. The product name and Varden branding shown in catalog imagery are presentation only. The sealed secondary packaging and batch documentation must preserve the product and lot association through receipt and storage; do not use material whose association cannot be verified.

For laboratory research use only.

Not for human or veterinary consumption. Not a medicine, food, cosmetic, or household product. No dosing, cycle, administration, diagnostic, or treatment guidance is provided.

Pack configuration	10 vials x 5mg, 10 vials x 10mg