Varden research catalog
LL-37
Synthetic peptide research material supplied as a warehouse-specific analytical catalog material. Select the required pack configuration before adding it to the cart.
- Catalog number
- VB-USA-LL-37
- Material class
- Synthetic peptide research material
- Fulfilment
- Selected regional warehouse only
- Availability
- Pack-specific; sold-out configurations remain visible
Scientific reference profile
- CAS
- 154947-66-7
- PubChem CID
- 16198951
- Molecular formula
- C205H340N60O53
- Molecular mass
- 4493 g/mol
- Sequence / composition notation
- [LL-37, 37 aa]
- Reference sources
- PubChem record

Chemical identifiers and 2D structure are sourced from the linked PubChem record.
Documentation and handling
Identity, purity, storage requirements, and analytical suitability must be evaluated against the batch-specific documentation. Reference identifiers on this page do not establish the identity or purity of a dispatched batch.
- Use appropriate laboratory controls, containment, and validated analytical methods.
- Keep the material secured and accessible only to qualified personnel.
Actual dispatched vials are unlabeled. The product name and Varden branding shown in catalog imagery are presentation only. The sealed secondary packaging and batch documentation must preserve the product and lot association through receipt and storage; do not use material whose association cannot be verified.
Not for human or veterinary consumption. Not a medicine, food, cosmetic, or household product. No dosing, cycle, administration, diagnostic, or treatment guidance is provided.


Reviews
There are no reviews yet.