FOXO4-DRI

$555.00USD · research material

  • Warehouse-specific pack configuration
  • Scientific identifiers shown only where unambiguously verified
  • Strictly for laboratory research use
  • Actual dispatched vials are unlabeled
SKU: VB-EU-FOXO4-DRI Category:
Catalog image ≠ dispatched vialThe primary vial is shipped unlabeled; verify the sealed secondary packaging and batch record before handling.

Varden research catalog

FOXO4-DRI

Synthetic peptide research material supplied as a warehouse-specific analytical catalog material. Select the required pack configuration before adding it to the cart.

Catalog number
VB-EU-FOXO4-DRI
Material class
Synthetic peptide research material
Fulfilment
Selected regional warehouse only
Availability
Pack-specific; sold-out configurations remain visible

Scientific reference profile

CAS
2460055-10-9
PubChem CID
167312269
Molecular formula
C228H388N86O64
Molecular mass
5358 g/mol
Sequence / composition notation
LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG
Reference sources
PubChem record
2D structural representation for FOXO4-DRI
Reference 2D structure from PubChem. Open source record

Identifiers refer to the PubChem FOXO4-DRI record.

Documentation and handling

Identity, purity, storage requirements, and analytical suitability must be evaluated against the batch-specific documentation. Reference identifiers on this page do not establish the identity or purity of a dispatched batch.

  • Use appropriate laboratory controls, containment, and validated analytical methods.
  • Keep the material secured and accessible only to qualified personnel.
Unlabeled primary vial

Actual dispatched vials are unlabeled. The product name and Varden branding shown in catalog imagery are presentation only. The sealed secondary packaging and batch documentation must preserve the product and lot association through receipt and storage; do not use material whose association cannot be verified.

For laboratory research use only.

Not for human or veterinary consumption. Not a medicine, food, cosmetic, or household product. No dosing, cycle, administration, diagnostic, or treatment guidance is provided.

Pack configuration

10 vials x 5mg

Reviews

There are no reviews yet.

Verified-purchase reviews are submitted through the private link sent after delivery. No customer account is required.

Regional research catalog

Select your shipping region

Availability is warehouse-specific. Your delivery country is verified again during checkout.

An essential preference cookie stores this selection for 30 days. No advertising tracker is used.

Scroll to Top